Lineage for d1e8ua_ (1e8u A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398195Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2398414Protein Paramyxovirus hemagglutinin-neuraminidase head domain [63823] (1 species)
  7. 2398415Species Newcastle disease virus [TaxId:11176] [63824] (5 PDB entries)
  8. 2398418Domain d1e8ua_: 1e8u A: [59389]
    complexed with ca, nag, slb

Details for d1e8ua_

PDB Entry: 1e8u (more details), 2 Å

PDB Description: structure of the multifunctional paramyxovirus hemagglutinin- neuraminidase
PDB Compounds: (A:) hemagglutinin-neuraminidase

SCOPe Domain Sequences for d1e8ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8ua_ b.68.1.1 (A:) Paramyxovirus hemagglutinin-neuraminidase head domain {Newcastle disease virus [TaxId: 11176]}
gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
siaeisntlfgefrivpllveilkndg

SCOPe Domain Coordinates for d1e8ua_:

Click to download the PDB-style file with coordinates for d1e8ua_.
(The format of our PDB-style files is described here.)

Timeline for d1e8ua_: