Lineage for d1e8tb_ (1e8t B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065191Protein Paramyxovirus hemagglutinin-neuraminidase head domain [63823] (1 species)
  7. 2065192Species Newcastle disease virus [TaxId:11176] [63824] (5 PDB entries)
  8. 2065200Domain d1e8tb_: 1e8t B: [59388]
    complexed with ca, gol, nag

Details for d1e8tb_

PDB Entry: 1e8t (more details), 2.5 Å

PDB Description: structure of the multifunctional paramyxovirus hemagglutinin-neuraminidase
PDB Compounds: (B:) hemagglutinin-neuraminidase

SCOPe Domain Sequences for d1e8tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8tb_ b.68.1.1 (B:) Paramyxovirus hemagglutinin-neuraminidase head domain {Newcastle disease virus [TaxId: 11176]}
gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
siaeisntlfgefrivpllveilkndgvre

SCOPe Domain Coordinates for d1e8tb_:

Click to download the PDB-style file with coordinates for d1e8tb_.
(The format of our PDB-style files is described here.)

Timeline for d1e8tb_: