Lineage for d1e8pa_ (1e8p A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038324Fold g.55: Cellulose docking domain, dockering [64570] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 3038325Superfamily g.55.1: Cellulose docking domain, dockering [64571] (1 family) (S)
    automatically mapped to Pfam PF02013
  5. 3038326Family g.55.1.1: Cellulose docking domain, dockering [64572] (1 protein)
  6. 3038327Protein Cellulose docking domain, dockering [64573] (1 species)
  7. 3038328Species Piromyces equi [TaxId:99929] [64574] (2 PDB entries)
  8. 3038329Domain d1e8pa_: 1e8p A: [59385]

Details for d1e8pa_

PDB Entry: 1e8p (more details)

PDB Description: characterisation of the cellulose docking domain from piromyces equi
PDB Compounds: (A:) endoglucanase 45a

SCOPe Domain Sequences for d1e8pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8pa_ g.55.1.1 (A:) Cellulose docking domain, dockering {Piromyces equi [TaxId: 99929]}
ascwaqsqgynccnnpsstkveytdasgqwgvqngqwcgidysygq

SCOPe Domain Coordinates for d1e8pa_:

Click to download the PDB-style file with coordinates for d1e8pa_.
(The format of our PDB-style files is described here.)

Timeline for d1e8pa_: