Lineage for d1e7wa_ (1e7w A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 975436Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 975760Protein Dihydropteridin reductase (pteridine reductase) [51769] (6 species)
  7. 975763Species Leishmania major [TaxId:5664] [63926] (10 PDB entries)
    Uniprot Q01782
  8. 975764Domain d1e7wa_: 1e7w A: [59373]
    complexed with edo, mtx, ndp

Details for d1e7wa_

PDB Entry: 1e7w (more details), 1.75 Å

PDB Description: one active site, two modes of reduction correlate the mechanism of leishmania pteridine reductase with pterin metabolism and antifolate drug resistance in trpanosomes
PDB Compounds: (A:) pteridine reductase

SCOPe Domain Sequences for d1e7wa_:

Sequence, based on SEQRES records: (download)

>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrnded
ghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamt
nqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrsk
vplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra

Sequence, based on observed residues (ATOM records): (download)

>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapvssapvtlftrcaelvaacythwgrcdvlvnnassfyptpllreametata
dlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgal
egltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvv
iflcsskakyitgtcvkvdggysltra

SCOPe Domain Coordinates for d1e7wa_:

Click to download the PDB-style file with coordinates for d1e7wa_.
(The format of our PDB-style files is described here.)

Timeline for d1e7wa_: