Lineage for d1e7wa_ (1e7w A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66266Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (26 proteins)
  6. 66363Protein Dihydropteridin reductase (pteridine reductase) [51769] (3 species)
  7. 66366Species Leishmania major [TaxId:5664] [63926] (1 PDB entry)
  8. 66367Domain d1e7wa_: 1e7w A: [59373]

Details for d1e7wa_

PDB Entry: 1e7w (more details), 1.75 Å

PDB Description: one active site, two modes of reduction correlate the mechanism of leishmania pteridine reductase with pterin metabolism and antifolate drug resistance in trpanosomes

SCOP Domain Sequences for d1e7wa_:

Sequence, based on SEQRES records: (download)

>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrnded
ghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamt
nqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrsk
vplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra

Sequence, based on observed residues (ATOM records): (download)

>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapvssapvtlftrcaelvaacythwgrcdvlvnnassfyptpllreametata
dlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgal
egltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvv
iflcsskakyitgtcvkvdggysltra

SCOP Domain Coordinates for d1e7wa_:

Click to download the PDB-style file with coordinates for d1e7wa_.
(The format of our PDB-style files is described here.)

Timeline for d1e7wa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e7wb_