Lineage for d1e7pj3 (1e7p J:251-371)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85568Fold d.168: Succinate dehydrogenase/fumarate reductase catalytic domain [56424] (1 superfamily)
  4. 85569Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56425] (1 family) (S)
  5. 85570Family d.168.1.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56426] (3 proteins)
  6. 85584Protein Fumarate reductase flavoprotein subunit [56429] (2 species)
  7. 85588Species Wolinella succinogenes [TaxId:844] [56431] (3 PDB entries)
  8. 85596Domain d1e7pj3: 1e7p J:251-371 [59367]
    Other proteins in same PDB: d1e7pa1, d1e7pa2, d1e7pb1, d1e7pb2, d1e7pc_, d1e7pd1, d1e7pd2, d1e7pe1, d1e7pe2, d1e7pf_, d1e7pg1, d1e7pg2, d1e7ph1, d1e7ph2, d1e7pi_, d1e7pj1, d1e7pj2, d1e7pk1, d1e7pk2, d1e7pl_

Details for d1e7pj3

PDB Entry: 1e7p (more details), 3.1 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes

SCOP Domain Sequences for d1e7pj3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7pj3 d.168.1.1 (J:251-371) Fumarate reductase flavoprotein subunit {Wolinella succinogenes}
meavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelasrdvvsrrmie
hirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaekwapvlpmqhy
s

SCOP Domain Coordinates for d1e7pj3:

Click to download the PDB-style file with coordinates for d1e7pj3.
(The format of our PDB-style files is described here.)

Timeline for d1e7pj3: