Lineage for d1e7pj1 (1e7p J:458-655)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45997Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
  4. 46031Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase C-terminal domain [46977] (1 family) (S)
  5. 46032Family a.7.3.1: Succinate dehydrogenase/fumarate reductase C-terminal domain [46978] (2 proteins)
  6. 46033Protein Fumarate reductase flavoprotein subunit [46981] (2 species)
  7. 46037Species Wolinella succinogenes [TaxId:844] [46983] (3 PDB entries)
  8. 46045Domain d1e7pj1: 1e7p J:458-655 [59365]
    Other proteins in same PDB: d1e7pa2, d1e7pa3, d1e7pb1, d1e7pb2, d1e7pc_, d1e7pd2, d1e7pd3, d1e7pe1, d1e7pe2, d1e7pf_, d1e7pg2, d1e7pg3, d1e7ph1, d1e7ph2, d1e7pi_, d1e7pj2, d1e7pj3, d1e7pk1, d1e7pk2, d1e7pl_

Details for d1e7pj1

PDB Entry: 1e7p (more details), 3.1 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes

SCOP Domain Sequences for d1e7pj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7pj1 a.7.3.1 (J:458-655) Fumarate reductase flavoprotein subunit {Wolinella succinogenes}
kgtedvfkiknrmkdvmddnvgifrdgphlekavkeleelykksknvgiknkrlhanpel
eeayrvpmmlkvalcvakgaldrtesrgahnredypkrddinwlnrtlaswpnpeqtlpt
leyealdvnemeiapgyrgygakgnyienplsvkrqeeidkiqseleaagkdrhaiqeal
mpyelpakykarnerlgd

SCOP Domain Coordinates for d1e7pj1:

Click to download the PDB-style file with coordinates for d1e7pj1.
(The format of our PDB-style files is described here.)

Timeline for d1e7pj1: