![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
![]() | Domain d1e7ph1: 1e7p H:107-239 [59362] Other proteins in same PDB: d1e7pa1, d1e7pa2, d1e7pa3, d1e7pb2, d1e7pc_, d1e7pd1, d1e7pd2, d1e7pd3, d1e7pe2, d1e7pf_, d1e7pg1, d1e7pg2, d1e7pg3, d1e7ph2, d1e7pi_, d1e7pj1, d1e7pj2, d1e7pj3, d1e7pk2, d1e7pl_ complexed with f3s, fad, fes, hem, lmt, mla, na, sf4 |
PDB Entry: 1e7p (more details), 3.1 Å
SCOPe Domain Sequences for d1e7ph1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e7ph1 a.1.2.1 (H:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs kiaylrrkmvsvn
Timeline for d1e7ph1: