SCOP 1.59: Domain d1e7ph1: 1e7p H:107-239

Lineage for d1e7ph1 (1e7p H:107-239)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families)

5. Family a.1.2.1: Fumarate reductase iron-sulfur protein, C-terminal domain [46549] (1 protein)

6. Protein Fumarate reductase iron-sulfur protein, C-terminal domain [46550] (2 species)

7. Species Wolinella succinogenes [TaxId:844] [46552] (3 PDB entries)

8. Domain d1e7ph1: 1e7p H:107-239 [59362]
   Other proteins in same PDB: d1e7pa1, d1e7pa2, d1e7pa3, d1e7pb2, d1e7pc_, d1e7pd1, d1e7pd2, d1e7pd3, d1e7pe2, d1e7pf_, d1e7pg1, d1e7pg2, d1e7pg3, d1e7ph2, d1e7pi_, d1e7pj1, d1e7pj2, d1e7pj3, d1e7pk2, d1e7pl_

Details for d1e7ph1

PDB Entry: 1e7p, 3.1 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes

SCOP Domain Sequences for d1e7ph1:

Sequence; same for both SEQRES and ATOM records:

>d1e7ph1 a.1.2.1 (H:107-239) Fumarate reductase iron-sulfur protein, C-terminal domain {Wolinella succinogenes}
tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim
redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs
kiaylrrkmvsvn

Timeline for d1e7ph1:

• d1e7ph1 first appeared in SCOP 1.57
  
• d1e7ph1 appears in SCOP 1.61
  
• d1e7ph1 appears in the current release, SCOPe 2.08