Lineage for d1e7pd1 (1e7p D:458-655)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2309960Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 2309961Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 2309968Protein Fumarate reductase [46981] (2 species)
  7. 2309980Species Wolinella succinogenes [TaxId:844] [46983] (6 PDB entries)
  8. 2309992Domain d1e7pd1: 1e7p D:458-655 [59353]
    Other proteins in same PDB: d1e7pa2, d1e7pa3, d1e7pb1, d1e7pb2, d1e7pc_, d1e7pd2, d1e7pd3, d1e7pe1, d1e7pe2, d1e7pf_, d1e7pg2, d1e7pg3, d1e7ph1, d1e7ph2, d1e7pi_, d1e7pj2, d1e7pj3, d1e7pk1, d1e7pk2, d1e7pl_
    complexed with f3s, fad, fes, hem, lmt, mla, na, sf4

Details for d1e7pd1

PDB Entry: 1e7p (more details), 3.1 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (D:) Fumarate reductase flavoprotein subunit

SCOPe Domain Sequences for d1e7pd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7pd1 a.7.3.1 (D:458-655) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
kgtedvfkiknrmkdvmddnvgifrdgphlekavkeleelykksknvgiknkrlhanpel
eeayrvpmmlkvalcvakgaldrtesrgahnredypkrddinwlnrtlaswpnpeqtlpt
leyealdvnemeiapgyrgygakgnyienplsvkrqeeidkiqseleaagkdrhaiqeal
mpyelpakykarnerlgd

SCOPe Domain Coordinates for d1e7pd1:

Click to download the PDB-style file with coordinates for d1e7pd1.
(The format of our PDB-style files is described here.)

Timeline for d1e7pd1: