![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (3 species) |
![]() | Domain d1e7pb2: 1e7p B:1-106 [59351] Other proteins in same PDB: d1e7pa1, d1e7pa2, d1e7pa3, d1e7pb1, d1e7pc_, d1e7pd1, d1e7pd2, d1e7pd3, d1e7pe1, d1e7pf_, d1e7pg1, d1e7pg2, d1e7pg3, d1e7ph1, d1e7pi_, d1e7pj1, d1e7pj2, d1e7pj3, d1e7pk1, d1e7pl_ complexed with f3s, fad, fes, hem, lmt, mla, na, sf4 |
PDB Entry: 1e7p (more details), 3.1 Å
SCOPe Domain Sequences for d1e7pb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e7pb2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvd
Timeline for d1e7pb2: