Lineage for d1e7pb1 (1e7p B:107-239)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 760029Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
    contains two Fe4-S4 clusters
  5. 760030Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (2 proteins)
  6. 760031Protein Fumarate reductase [46550] (2 species)
  7. 760043Species Wolinella succinogenes [TaxId:844] [46552] (5 PDB entries)
  8. 760052Domain d1e7pb1: 1e7p B:107-239 [59350]
    Other proteins in same PDB: d1e7pa1, d1e7pa2, d1e7pa3, d1e7pb2, d1e7pc_, d1e7pd1, d1e7pd2, d1e7pd3, d1e7pe2, d1e7pf_, d1e7pg1, d1e7pg2, d1e7pg3, d1e7ph2, d1e7pi_, d1e7pj1, d1e7pj2, d1e7pj3, d1e7pk2, d1e7pl_

Details for d1e7pb1

PDB Entry: 1e7p (more details), 3.1 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (B:) fumarate reductase iron-sulfur protein

SCOP Domain Sequences for d1e7pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7pb1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim
redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs
kiaylrrkmvsvn

SCOP Domain Coordinates for d1e7pb1:

Click to download the PDB-style file with coordinates for d1e7pb1.
(The format of our PDB-style files is described here.)

Timeline for d1e7pb1: