Lineage for d1e7ja_ (1e7j A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725579Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 1725580Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 1725581Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 1725599Protein HMG-D [47100] (1 species)
  7. 1725600Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47101] (3 PDB entries)
  8. 1725603Domain d1e7ja_: 1e7j A: [59344]
    protein/DNA complex

Details for d1e7ja_

PDB Entry: 1e7j (more details)

PDB Description: hmg-d complexed to a bulge dna
PDB Compounds: (A:) high mobility group protein d

SCOPe Domain Sequences for d1e7ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7ja_ a.21.1.1 (A:) HMG-D {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
msdkpkrplsaymlwlnsaresikrenpgikvtevakrggelwramkdkseweakaakak
ddydravkefeang

SCOPe Domain Coordinates for d1e7ja_:

Click to download the PDB-style file with coordinates for d1e7ja_.
(The format of our PDB-style files is described here.)

Timeline for d1e7ja_: