| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
| Family d.26.3.1: Chitinase insertion domain [54557] (8 proteins) |
| Protein Chitinase B [54560] (1 species) |
| Species Serratia marcescens [TaxId:615] [54561] (9 PDB entries) |
| Domain d1e6zb3: 1e6z B:292-379 [59335] Other proteins in same PDB: d1e6za1, d1e6za2, d1e6zb1, d1e6zb2 complexed with nag, ngo, so4 |
PDB Entry: 1e6z (more details), 1.99 Å
SCOP Domain Sequences for d1e6zb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6zb3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty
Timeline for d1e6zb3: