![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
![]() | Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) ![]() |
![]() | Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins) |
![]() | Protein Chitinase B, C-terminal domain [51061] (1 species) |
![]() | Species Serratia marcescens [TaxId:615] [51062] (14 PDB entries) |
![]() | Domain d1e6zb1: 1e6z B:447-499 [59333] Other proteins in same PDB: d1e6za2, d1e6za3, d1e6zb2, d1e6zb3 complexed with nag, ngo, so4 |
PDB Entry: 1e6z (more details), 1.99 Å
SCOP Domain Sequences for d1e6zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6zb1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens} nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva
Timeline for d1e6zb1: