SCOP 1.59: Domain d1e6zb1: 1e6z B:447-499

Lineage for d1e6zb1 (1e6z B:447-499)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.72: WW domain-like [51044] (2 superfamilies)

4. Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family)

5. Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)

6. Protein Chitinase B, C-terminal domain [51061] (1 species)

7. Species Serratia marcescens [TaxId:615] [51062] (6 PDB entries)

8. Domain d1e6zb1: 1e6z B:447-499 [59333]
   Other proteins in same PDB: d1e6za2, d1e6za3, d1e6zb2, d1e6zb3

Details for d1e6zb1

PDB Entry: 1e6z, 1.99 Å

PDB Description: chitinase b from serratia marcescens wildtype in complex with catalytic intermediate

SCOP Domain Sequences for d1e6zb1:

Sequence; same for both SEQRES and ATOM records:

>d1e6zb1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva

Timeline for d1e6zb1:

• d1e6zb1 first appeared in SCOP 1.57
  
• d1e6zb1 appears in SCOP 1.61
  
• d1e6zb1 appears in the current release, SCOPe 2.08