Lineage for d1e6zb1 (1e6z B:447-499)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811242Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2811399Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) (S)
  5. 2811400Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)
  6. 2811407Protein Chitinase B, C-terminal domain [51061] (1 species)
  7. 2811408Species Serratia marcescens [TaxId:615] [51062] (18 PDB entries)
  8. 2811428Domain d1e6zb1: 1e6z B:447-499 [59333]
    Other proteins in same PDB: d1e6za2, d1e6za3, d1e6zb2, d1e6zb3
    complexed with nag, ngo, so4

Details for d1e6zb1

PDB Entry: 1e6z (more details), 1.99 Å

PDB Description: chitinase b from serratia marcescens wildtype in complex with catalytic intermediate
PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1e6zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6zb1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva

SCOPe Domain Coordinates for d1e6zb1:

Click to download the PDB-style file with coordinates for d1e6zb1.
(The format of our PDB-style files is described here.)

Timeline for d1e6zb1: