Lineage for d1e6rb3 (1e6r B:292-379)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720612Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 720613Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 720662Protein Chitinase B [54560] (1 species)
  7. 720663Species Serratia marcescens [TaxId:615] [54561] (14 PDB entries)
  8. 720691Domain d1e6rb3: 1e6r B:292-379 [59325]
    Other proteins in same PDB: d1e6ra1, d1e6ra2, d1e6rb1, d1e6rb2
    complexed with ami, naa, so4

Details for d1e6rb3

PDB Entry: 1e6r (more details), 2.5 Å

PDB Description: chitinase b from serratia marcescens wildtype in complex with inhibitor allosamidin
PDB Compounds: (B:) chitinase b

SCOP Domain Sequences for d1e6rb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6rb3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens [TaxId: 615]}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOP Domain Coordinates for d1e6rb3:

Click to download the PDB-style file with coordinates for d1e6rb3.
(The format of our PDB-style files is described here.)

Timeline for d1e6rb3: