![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (6 proteins) |
![]() | Protein Chitinase B [54560] (1 species) |
![]() | Species Serratia marcescens [TaxId:615] [54561] (8 PDB entries) |
![]() | Domain d1e6rb3: 1e6r B:292-379 [59325] Other proteins in same PDB: d1e6ra1, d1e6ra2, d1e6rb1, d1e6rb2 |
PDB Entry: 1e6r (more details), 2.5 Å
SCOP Domain Sequences for d1e6rb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6rb3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens} ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg nygyqrlwndktktpylyhaqnglfvty
Timeline for d1e6rb3: