Class b: All beta proteins [48724] (180 folds) |
Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) |
Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins) |
Protein Chitinase B, C-terminal domain [51061] (1 species) |
Species Serratia marcescens [TaxId:615] [51062] (18 PDB entries) |
Domain d1e6rb1: 1e6r B:447-499 [59323] Other proteins in same PDB: d1e6ra2, d1e6ra3, d1e6rb2, d1e6rb3 complexed with ami, so4 |
PDB Entry: 1e6r (more details), 2.5 Å
SCOPe Domain Sequences for d1e6rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6rb1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]} nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva
Timeline for d1e6rb1: