Lineage for d1e6pb3 (1e6p B:292-379)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255712Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 255830Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 255831Family d.26.3.1: Chitinase insertion domain [54557] (8 proteins)
  6. 255857Protein Chitinase B [54560] (1 species)
  7. 255858Species Serratia marcescens [TaxId:615] [54561] (9 PDB entries)
  8. 255862Domain d1e6pb3: 1e6p B:292-379 [59319]
    Other proteins in same PDB: d1e6pa1, d1e6pa2, d1e6pb1, d1e6pb2
    complexed with gol, so4; mutant

Details for d1e6pb3

PDB Entry: 1e6p (more details), 1.7 Å

PDB Description: chitinase b from serratia marcescens inactive mutant e144q

SCOP Domain Sequences for d1e6pb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6pb3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOP Domain Coordinates for d1e6pb3:

Click to download the PDB-style file with coordinates for d1e6pb3.
(The format of our PDB-style files is described here.)

Timeline for d1e6pb3: