Lineage for d1e6pb1 (1e6p B:447-499)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420693Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2420848Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) (S)
  5. 2420849Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)
  6. 2420856Protein Chitinase B, C-terminal domain [51061] (1 species)
  7. 2420857Species Serratia marcescens [TaxId:615] [51062] (18 PDB entries)
  8. 2420863Domain d1e6pb1: 1e6p B:447-499 [59317]
    Other proteins in same PDB: d1e6pa2, d1e6pa3, d1e6pb2, d1e6pb3
    complexed with gol, so4; mutant

Details for d1e6pb1

PDB Entry: 1e6p (more details), 1.7 Å

PDB Description: chitinase b from serratia marcescens inactive mutant e144q
PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1e6pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6pb1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva

SCOPe Domain Coordinates for d1e6pb1:

Click to download the PDB-style file with coordinates for d1e6pb1.
(The format of our PDB-style files is described here.)

Timeline for d1e6pb1: