Lineage for d1e6pa1 (1e6p A:447-498)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 302477Fold b.72: WW domain-like [51044] (2 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 302510Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) (S)
  5. 302511Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)
  6. 302518Protein Chitinase B, C-terminal domain [51061] (1 species)
  7. 302519Species Serratia marcescens [TaxId:615] [51062] (10 PDB entries)
  8. 302524Domain d1e6pa1: 1e6p A:447-498 [59314]
    Other proteins in same PDB: d1e6pa2, d1e6pa3, d1e6pb2, d1e6pb3

Details for d1e6pa1

PDB Entry: 1e6p (more details), 1.7 Å

PDB Description: chitinase b from serratia marcescens inactive mutant e144q

SCOP Domain Sequences for d1e6pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6pa1 b.72.2.1 (A:447-498) Chitinase B, C-terminal domain {Serratia marcescens}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrv

SCOP Domain Coordinates for d1e6pa1:

Click to download the PDB-style file with coordinates for d1e6pa1.
(The format of our PDB-style files is described here.)

Timeline for d1e6pa1: