Lineage for d1e6nb3 (1e6n B:292-379)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255712Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 255830Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 255831Family d.26.3.1: Chitinase insertion domain [54557] (8 proteins)
  6. 255857Protein Chitinase B [54560] (1 species)
  7. 255858Species Serratia marcescens [TaxId:615] [54561] (9 PDB entries)
  8. 255874Domain d1e6nb3: 1e6n B:292-379 [59313]
    Other proteins in same PDB: d1e6na1, d1e6na2, d1e6nb1, d1e6nb2
    complexed with gol, nag, so4; mutant

Details for d1e6nb3

PDB Entry: 1e6n (more details), 2.25 Å

PDB Description: chitinase b from serratia marcescens inactive mutant e144q in complex with n-acetylglucosamine-pentamer

SCOP Domain Sequences for d1e6nb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6nb3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOP Domain Coordinates for d1e6nb3:

Click to download the PDB-style file with coordinates for d1e6nb3.
(The format of our PDB-style files is described here.)

Timeline for d1e6nb3: