Lineage for d1e6nb1 (1e6n B:447-499)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1136466Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 1136547Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) (S)
  5. 1136548Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)
  6. 1136555Protein Chitinase B, C-terminal domain [51061] (1 species)
  7. 1136556Species Serratia marcescens [TaxId:615] [51062] (14 PDB entries)
  8. 1136582Domain d1e6nb1: 1e6n B:447-499 [59311]
    Other proteins in same PDB: d1e6na2, d1e6na3, d1e6nb2, d1e6nb3
    complexed with gol, so4; mutant

Details for d1e6nb1

PDB Entry: 1e6n (more details), 2.25 Å

PDB Description: chitinase b from serratia marcescens inactive mutant e144q in complex with n-acetylglucosamine-pentamer
PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1e6nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6nb1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva

SCOPe Domain Coordinates for d1e6nb1:

Click to download the PDB-style file with coordinates for d1e6nb1.
(The format of our PDB-style files is described here.)

Timeline for d1e6nb1: