| Class b: All beta proteins [48724] (126 folds) |
| Fold b.72: WW domain-like [51044] (2 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) ![]() |
| Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins) |
| Protein Chitinase B, C-terminal domain [51061] (1 species) |
| Species Serratia marcescens [TaxId:615] [51062] (10 PDB entries) |
| Domain d1e6nb1: 1e6n B:447-499 [59311] Other proteins in same PDB: d1e6na2, d1e6na3, d1e6nb2, d1e6nb3 complexed with gol, nag, so4; mutant |
PDB Entry: 1e6n (more details), 2.25 Å
SCOP Domain Sequences for d1e6nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6nb1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva
Timeline for d1e6nb1: