Lineage for d1e6la_ (1e6l A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481070Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 481071Family c.23.1.1: CheY-related [52173] (17 proteins)
  6. 481079Protein CheY protein [52174] (4 species)
  7. 481080Species Escherichia coli [TaxId:562] [52175] (30 PDB entries)
  8. 481092Domain d1e6la_: 1e6l A: [59307]

Details for d1e6la_

PDB Entry: 1e6l (more details), 1.9 Å

PDB Description: two-component signal transduction system d13a mutant of chey

SCOP Domain Sequences for d1e6la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6la_ c.23.1.1 (A:) CheY protein {Escherichia coli}
dkelkflvvdafstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpn
mdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleeklnk
ifeklgm

SCOP Domain Coordinates for d1e6la_:

Click to download the PDB-style file with coordinates for d1e6la_.
(The format of our PDB-style files is described here.)

Timeline for d1e6la_: