Lineage for d1e6fa_ (1e6f A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)
  6. Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [63822] (5 PDB entries)
  8. Domain d1e6fa_: 1e6f A: [59304]
    repeat 11, IGF-II binding domain

Details for d1e6fa_

PDB Entry: 1e6f (more details), 1.7500000000000002 Å

PDB Description: human mir-receptor, repeat 11
PDB Compounds: (A:) cation-independent mannose-6-phosphate receptor

SCOPe Domain Sequences for d1e6fa_:

Sequence, based on SEQRES records: (download)

>d1e6fa_ b.64.1.1 (A:) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Human (Homo sapiens) [TaxId: 9606]}
ddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacfgqtris
vgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmlisldkqt
ctlffswhtplace

Sequence, based on observed residues (ATOM records): (download)

>d1e6fa_ b.64.1.1 (A:) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Human (Homo sapiens) [TaxId: 9606]}
ddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacfgqtris
vgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpnrpmlisldkqtctlff
swhtplace

SCOPe Domain Coordinates for d1e6fa_ are not available.

Timeline for d1e6fa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e6fb_