Lineage for d1e6ea1 (1e6e A:107-331)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2457627Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)
  6. 2457631Protein Adrenodoxin reductase of mitochondrial p450 systems [51909] (1 species)
  7. 2457632Species Cow (Bos taurus) [TaxId:9913] [51910] (6 PDB entries)
  8. 2457635Domain d1e6ea1: 1e6e A:107-331 [59298]
    Other proteins in same PDB: d1e6ea2, d1e6eb_, d1e6ec2, d1e6ed_
    complexed with fad, fes, so4

Details for d1e6ea1

PDB Entry: 1e6e (more details), 2.3 Å

PDB Description: adrenodoxin reductase/adrenodoxin complex of mitochondrial p450 systems
PDB Compounds: (A:) nadph:adrenodoxin oxidoreductase

SCOPe Domain Sequences for d1e6ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ea1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]}
hqaldipgeelpgvfsarafvgwynglpenrelapdlscdtavilgqgnvaldvarillt
ppdhlektditeaalgalrqsrvktvwivgrrgplqvaftikelremiqlpgtrpmldpa
dflglqdrikeaarprkrlmelllrtatekpgveeaarrasasrawglrffrspqqvlps
pdgrraagirlavtrlegigeatravptgdvedlpcglvlssigy

SCOPe Domain Coordinates for d1e6ea1:

Click to download the PDB-style file with coordinates for d1e6ea1.
(The format of our PDB-style files is described here.)

Timeline for d1e6ea1: