SCOPe 2.07: Domain d1e6cb_: 1e6c B:

Lineage for d1e6cb_ (1e6c B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
   similar to the nucleotide/nucleoside kinases but acts on different substrate
   automatically mapped to Pfam PF01202

6. Protein Shikimate kinase (AroK) [52567] (4 species)

7. Species Erwinia chrysanthemi [TaxId:556] [52568] (3 PDB entries)

8. Domain d1e6cb_: 1e6c B: [59297]
   complexed with cl, mpd, mrd, po4; mutant

Details for d1e6cb_

PDB Entry: 1e6c, 1.8 Å

PDB Description: k15m mutant of shikimate kinase from erwinia chrysanthemi

PDB Compounds: (B:) Shikimate kinase

SCOPe Domain Sequences for d1e6cb_:

Sequence; same for both SEQRES and ATOM records:

>d1e6cb_ c.37.1.2 (B:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}
mtepifmvgargcgmttvgrelaralgyefvdtdifmqhtsgmtvadvvaaegwpgfrrr
esealqavatpnrvvatgggmvlleqnrqfmrahgtvvylfapaeelalrlqaslqahqr
ptltgrpiaeemeavlrerealyqdvahyvvdatqppaaivcelmqtmrl

Timeline for d1e6cb_:

• d1e6cb_ first appeared in SCOP 1.57
  
• d1e6cb_ appears in SCOPe 2.06
  
• d1e6cb_ appears in the current release, SCOPe 2.08