![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins) similar to the nucleotide/nucleoside kinases but acts on different substrate automatically mapped to Pfam PF01202 |
![]() | Protein Shikimate kinase (AroK) [52567] (4 species) |
![]() | Species Erwinia chrysanthemi [TaxId:556] [52568] (3 PDB entries) |
![]() | Domain d1e6cb_: 1e6c B: [59297] complexed with cl, mpd, mrd, po4; mutant |
PDB Entry: 1e6c (more details), 1.8 Å
SCOPe Domain Sequences for d1e6cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6cb_ c.37.1.2 (B:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} mtepifmvgargcgmttvgrelaralgyefvdtdifmqhtsgmtvadvvaaegwpgfrrr esealqavatpnrvvatgggmvlleqnrqfmrahgtvvylfapaeelalrlqaslqahqr ptltgrpiaeemeavlrerealyqdvahyvvdatqppaaivcelmqtmrl
Timeline for d1e6cb_: