![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class zeta GST [81353] (2 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [63556] (1 PDB entry) |
![]() | Domain d1e6ba1: 1e6b A:88-220 [59294] Other proteins in same PDB: d1e6ba2 complexed with bme |
PDB Entry: 1e6b (more details), 1.65 Å
SCOPe Domain Sequences for d1e6ba1:
Sequence, based on SEQRES records: (download)
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} pllprdlhkravnyqamsivlsgiqphqnlaviryieekinveektawvnnaitkgftal ekllvncagkhatgdeiyladlflapqihgainrfqinmepyptlakcyesynelpafqn alpekqpdapsst
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} pllprdlhkravnyqamsivlsgiqptawvnnaitkgftalekllvncagkhatgdeiyl adlflapqihgainrfqinmepyptlakcyesynelpafqnalpekqpdapsst
Timeline for d1e6ba1: