Lineage for d1e6ba1 (1e6b A:88-220)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1736162Protein Class zeta GST [81353] (2 species)
  7. 1736165Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [63556] (1 PDB entry)
  8. 1736166Domain d1e6ba1: 1e6b A:88-220 [59294]
    Other proteins in same PDB: d1e6ba2
    complexed with bme

Details for d1e6ba1

PDB Entry: 1e6b (more details), 1.65 Å

PDB Description: crystal structure of a zeta class glutathione s-transferase from arabidopsis thaliana
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1e6ba1:

Sequence, based on SEQRES records: (download)

>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pllprdlhkravnyqamsivlsgiqphqnlaviryieekinveektawvnnaitkgftal
ekllvncagkhatgdeiyladlflapqihgainrfqinmepyptlakcyesynelpafqn
alpekqpdapsst

Sequence, based on observed residues (ATOM records): (download)

>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pllprdlhkravnyqamsivlsgiqptawvnnaitkgftalekllvncagkhatgdeiyl
adlflapqihgainrfqinmepyptlakcyesynelpafqnalpekqpdapsst

SCOPe Domain Coordinates for d1e6ba1:

Click to download the PDB-style file with coordinates for d1e6ba1.
(The format of our PDB-style files is described here.)

Timeline for d1e6ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e6ba2