Lineage for d1e6aa_ (1e6a A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59698Superfamily b.40.5: Inorganic pyrophosphatase [50324] (1 family) (S)
  5. 59699Family b.40.5.1: Inorganic pyrophosphatase [50325] (1 protein)
  6. 59700Protein Inorganic pyrophosphatase [50326] (4 species)
  7. 59708Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50327] (10 PDB entries)
  8. 59711Domain d1e6aa_: 1e6a A: [59292]

Details for d1e6aa_

PDB Entry: 1e6a (more details), 1.9 Å

PDB Description: fluoride-inhibited substrate complex of saccharomyces cerevisiae inorganic pyrophosphatase

SCOP Domain Sequences for d1e6aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6aa_ b.40.5.1 (A:) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae)}
tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
dltnvtlpdtptyskaasdaippaslkadapidksidkwffisg

SCOP Domain Coordinates for d1e6aa_:

Click to download the PDB-style file with coordinates for d1e6aa_.
(The format of our PDB-style files is described here.)

Timeline for d1e6aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e6ab_