Lineage for d1e64a2 (1e64 A:142-303)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) 
Family c.25.1.1: Reductases [52344] (4 proteins) Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species) 
Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (8 PDB entries) 
Domain d1e64a2: 1e64 A:142-303 [59290]
Other proteins in same PDB: d1e64a1
Details for d1e64a2
PDB Entry: 1e64 (more details), 2.3 Å
PDB Description: ferredoxin:nadp+ reductase mutant with lys 75 replaced by gln (k75q)
SCOP Domain Sequences for d1e64a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e64a2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety
SCOP Domain Coordinates for d1e64a2:
Click to download the PDB-style file with coordinates for d1e64a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e64a2:
- d1e64a2 is new in SCOP 1.57
- d1e64a2 appears in SCOP 1.59
- d1e64a2 appears in the current release, SCOPe 2.07
View in 3D
