Lineage for d1e63a1 (1e63 A:9-141)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60076Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 60149Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 60166Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)
  6. 60175Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 60178Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [50420] (8 PDB entries)
  8. 60182Domain d1e63a1: 1e63 A:9-141 [59287]
    Other proteins in same PDB: d1e63a2

Details for d1e63a1

PDB Entry: 1e63 (more details), 2.3 Å

PDB Description: ferredoxin:nadp+ reductase mutant with lys 75 replaced by ser (k75s)

SCOP Domain Sequences for d1e63a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e63a1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeslrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgkeml

SCOP Domain Coordinates for d1e63a1:

Click to download the PDB-style file with coordinates for d1e63a1.
(The format of our PDB-style files is described here.)

Timeline for d1e63a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e63a2