![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
![]() | Family c.25.1.1: Reductases [52344] (4 proteins) |
![]() | Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species) |
![]() | Species Anabaena sp., pcc 7119 [TaxId:1167] [52350] (24 PDB entries) |
![]() | Domain d1e62a2: 1e62 A:142-303 [59286] Other proteins in same PDB: d1e62a1 complexed with fad, so4; mutant |
PDB Entry: 1e62 (more details), 2.3 Å
SCOPe Domain Sequences for d1e62a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e62a2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Anabaena sp., pcc 7119 [TaxId: 1167]} lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety
Timeline for d1e62a2: