Lineage for d1e62a2 (1e62 A:142-303)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68846Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 68847Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 68848Family c.25.1.1: Reductases [52344] (4 protein domains)
  6. 68852Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 68855Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (8 PDB entries)
  8. 68862Domain d1e62a2: 1e62 A:142-303 [59286]
    Other proteins in same PDB: d1e62a1

Details for d1e62a2

PDB Entry: 1e62 (more details), 2.3 Å

PDB Description: Ferredoxin:NADP+ reductase mutant with Lys 75 replaced by Arg (K75R)

SCOP Domain Sequences for d1e62a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e62a2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

SCOP Domain Coordinates for d1e62a2:

Click to download the PDB-style file with coordinates for d1e62a2.
(The format of our PDB-style files is described here.)

Timeline for d1e62a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e62a1