Lineage for d1e62a2 (1e62 A:142-303)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859732Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 2859751Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species)
  7. Species Anabaena sp., pcc 7119 [TaxId:1167] [52350] (19 PDB entries)
  8. 2859769Domain d1e62a2: 1e62 A:142-303 [59286]
    Other proteins in same PDB: d1e62a1
    complexed with fad, so4; mutant

Details for d1e62a2

PDB Entry: 1e62 (more details), 2.3 Å

PDB Description: ferredoxin:nadp+ reductase mutant with lys 75 replaced by arg (k75r)
PDB Compounds: (A:) ferredoxin-nadp+ reductase

SCOPe Domain Sequences for d1e62a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e62a2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Anabaena sp., pcc 7119 [TaxId: 1167]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

SCOPe Domain Coordinates for d1e62a2:

Click to download the PDB-style file with coordinates for d1e62a2.
(The format of our PDB-style files is described here.)

Timeline for d1e62a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e62a1