Class b: All beta proteins [48724] (149 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species) |
Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [50420] (19 PDB entries) |
Domain d1e62a1: 1e62 A:9-141 [59285] Other proteins in same PDB: d1e62a2 complexed with fad, so4; mutant |
PDB Entry: 1e62 (more details), 2.3 Å
SCOP Domain Sequences for d1e62a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e62a1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119} dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd kngkperlrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs evkitgpvgkeml
Timeline for d1e62a1: