Lineage for d1e5xa_ (1e5x A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127373Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
  4. 127374Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 127375Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)
  6. 127403Protein Threonine synthase [64172] (1 species)
  7. 127404Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [64173] (1 PDB entry)
  8. 127405Domain d1e5xa_: 1e5x A: [59283]

Details for d1e5xa_

PDB Entry: 1e5x (more details), 2.25 Å

PDB Description: structure of threonine synthase from arabidopsis thaliana

SCOP Domain Sequences for d1e5xa_:

Sequence, based on SEQRES records: (download)

>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana)}
ietavkpphrtednirdearrnrsnavnpfsakyvpfnaapgstesysldeivyrsrsgg
lldvehdmealkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeiddddivsafeg
nsnlfwaerfgkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgc
astgdtsaalsaycasagipsivflpankismaqlvqpiangafvlsidtdfdgcmklir
eitaelpiylanslnslrlegqktaaieilqqfdwqvpdwvivpggnlgniyafykgfkm
cqelglvdriprmvcaqaananplylhyksgwkdfkpmtasttfasaiqigdpvsidrav
yalkkcngiveeateeelmdamaqadstgmficphtgvaltalfklrnqgviaptdrtvv
vstahglkftqskidyhsnaipdmacrfsnppvdvkadfgavmdvlksylgsntlts

Sequence, based on observed residues (ATOM records): (download)

>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana)}
ietavkpphrtednirdenavnpfsakyvpfnaapgstesysldeivyrglldvehdmea
lkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeiddddivsafegnsnlfwaerf
gkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsaal
saycasagipsivflpankismaqlvqpiangafvlsidtdfdgcmklireitaelpiyl
anslnslrlegqktaaieilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvdri
prmvcaqaananplylhyksgwkdfkpvsidravyalkkcngiveeateeelmdamaqad
stgmficphtgvaltalfklrnqgviaptdrtvvvstahglkftqskidyhsnaipdmac
rfsnppvdvkadfgavmdvlksylgsntlts

SCOP Domain Coordinates for d1e5xa_:

Click to download the PDB-style file with coordinates for d1e5xa_.
(The format of our PDB-style files is described here.)

Timeline for d1e5xa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e5xb_