Lineage for d1e5wa3 (1e5w A:1-87)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 130888Superfamily d.15.1: Ubiquitin-like [54236] (5 families) (S)
  5. 130947Family d.15.1.4: First domain of FERM [54256] (4 proteins)
  6. 130957Protein Moesin [54257] (1 species)
  7. 130958Species Human (Homo sapiens) [TaxId:9606] [54258] (2 PDB entries)
  8. 130961Domain d1e5wa3: 1e5w A:1-87 [59282]
    Other proteins in same PDB: d1e5wa1, d1e5wa2

Details for d1e5wa3

PDB Entry: 1e5w (more details), 2.7 Å

PDB Description: Structure of isolated FERM domain and first long helix of moesin

SCOP Domain Sequences for d1e5wa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5wa3 d.15.1.4 (A:1-87) Moesin {Human (Homo sapiens)}
mpktisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlk
lnkkvtaqdvrkespllfkfrakfype

SCOP Domain Coordinates for d1e5wa3:

Click to download the PDB-style file with coordinates for d1e5wa3.
(The format of our PDB-style files is described here.)

Timeline for d1e5wa3: