SCOP 1.75: Domain d1e5wa2: 1e5w A:199-346

Lineage for d1e5wa2 (1e5w A:199-346)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (13 families)

5. Family b.55.1.5: Third domain of FERM [50776] (8 proteins)

6. Protein Moesin [50777] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50778] (3 PDB entries)
   Uniprot P26038 4-297

8. Domain d1e5wa2: 1e5w A:199-346 [59281]
   Other proteins in same PDB: d1e5wa1, d1e5wa3
   includes first long helix

Details for d1e5wa2

PDB Entry: 1e5w, 2.7 Å

PDB Description: Structure of isolated FERM domain and first long helix of moesin

PDB Compounds: (A:) moesin

SCOP Domain Sequences for d1e5wa2:

Sequence; same for both SEQRES and ATOM records:

>d1e5wa2 b.55.1.5 (A:199-346) Moesin {Human (Homo sapiens) [TaxId: 9606]}
emygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdtievqqmkaqareekhqkqm
eramlenekkkremaekekekierekee

Timeline for d1e5wa2:

• d1e5wa2 first appeared in SCOP 1.57
  
• d1e5wa2 appears in SCOP 1.73
  
• d1e5wa2 appears in SCOPe 2.01
  
• d1e5wa2 appears in the current release, SCOPe 2.08