Lineage for d1e5wa2 (1e5w A:199-346)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378166Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 378167Superfamily b.55.1: PH domain-like [50729] (8 families) (S)
  5. 378331Family b.55.1.5: Third domain of FERM [50776] (6 proteins)
  6. 378347Protein Moesin [50777] (1 species)
  7. 378348Species Human (Homo sapiens) [TaxId:9606] [50778] (2 PDB entries)
  8. 378351Domain d1e5wa2: 1e5w A:199-346 [59281]
    Other proteins in same PDB: d1e5wa1, d1e5wa3
    includes first long helix

Details for d1e5wa2

PDB Entry: 1e5w (more details), 2.7 Å

PDB Description: Structure of isolated FERM domain and first long helix of moesin

SCOP Domain Sequences for d1e5wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5wa2 b.55.1.5 (A:199-346) Moesin {Human (Homo sapiens)}
emygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdtievqqmkaqareekhqkqm
eramlenekkkremaekekekierekee

SCOP Domain Coordinates for d1e5wa2:

Click to download the PDB-style file with coordinates for d1e5wa2.
(The format of our PDB-style files is described here.)

Timeline for d1e5wa2: