Class b: All beta proteins [48724] (141 folds) |
Fold b.55: PH domain-like [50728] (1 superfamily) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (8 families) |
Family b.55.1.5: Third domain of FERM [50776] (6 proteins) |
Protein Moesin [50777] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50778] (2 PDB entries) |
Domain d1e5wa2: 1e5w A:199-346 [59281] Other proteins in same PDB: d1e5wa1, d1e5wa3 includes first long helix |
PDB Entry: 1e5w (more details), 2.7 Å
SCOP Domain Sequences for d1e5wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5wa2 b.55.1.5 (A:199-346) Moesin {Human (Homo sapiens)} emygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpwseirnisfndkkfvik pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdtievqqmkaqareekhqkqm eramlenekkkremaekekekierekee
Timeline for d1e5wa2: