![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
![]() | Protein Moesin [50777] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50778] (3 PDB entries) Uniprot P26038 4-297 |
![]() | Domain d1e5wa2: 1e5w A:199-346 [59281] Other proteins in same PDB: d1e5wa1, d1e5wa3 includes first long helix |
PDB Entry: 1e5w (more details), 2.7 Å
SCOPe Domain Sequences for d1e5wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5wa2 b.55.1.5 (A:199-346) Moesin {Human (Homo sapiens) [TaxId: 9606]} emygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpwseirnisfndkkfvik pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdtievqqmkaqareekhqkqm eramlenekkkremaekekekierekee
Timeline for d1e5wa2: