Lineage for d1e5wa1 (1e5w A:88-198)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637116Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 637131Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 637132Family a.11.2.1: Second domain of FERM [47032] (8 proteins)
  6. 637154Protein Moesin [47033] (1 species)
  7. 637155Species Human (Homo sapiens) [TaxId:9606] [47034] (3 PDB entries)
  8. 637158Domain d1e5wa1: 1e5w A:88-198 [59280]
    Other proteins in same PDB: d1e5wa2, d1e5wa3

Details for d1e5wa1

PDB Entry: 1e5w (more details), 2.7 Å

PDB Description: Structure of isolated FERM domain and first long helix of moesin
PDB Compounds: (A:) moesin

SCOP Domain Sequences for d1e5wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5wa1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]}
dvseeliqditqrlfflqvkegilnddiycppetavllasyavqskygdfnkevhksgyl
agdkllpqrvleqhklnkdqweeriqvwheehrgmlredavleylkiaqdl

SCOP Domain Coordinates for d1e5wa1:

Click to download the PDB-style file with coordinates for d1e5wa1.
(The format of our PDB-style files is described here.)

Timeline for d1e5wa1: