Lineage for d1e5wa1 (1e5w A:88-198)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) 
Superfamily a.11.2: Second domain of FERM [47031] (1 family) 
Family a.11.2.1: Second domain of FERM [47032] (3 proteins) Protein Moesin [47033] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47034] (2 PDB entries) 
Domain d1e5wa1: 1e5w A:88-198 [59280]
Other proteins in same PDB: d1e5wa2, d1e5wa3
Details for d1e5wa1
PDB Entry: 1e5w (more details), 2.7 Å
PDB Description: Structure of isolated FERM domain and first long helix of moesin
SCOP Domain Sequences for d1e5wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5wa1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens)}
dvseeliqditqrlfflqvkegilnddiycppetavllasyavqskygdfnkevhksgyl
agdkllpqrvleqhklnkdqweeriqvwheehrgmlredavleylkiaqdl
SCOP Domain Coordinates for d1e5wa1:
Click to download the PDB-style file with coordinates for d1e5wa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e5wa1:
- d1e5wa1 is new in SCOP 1.57
- d1e5wa1 appears in SCOP 1.59
- d1e5wa1 appears in the current release, SCOPe 2.08
View in 3D
