Lineage for d1e5sa_ (1e5s A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2070881Family b.82.2.4: Type II Proline 3-hydroxylase (proline oxidase) [63858] (1 protein)
  6. 2070882Protein Type II Proline 3-hydroxylase (proline oxidase) [63859] (1 species)
  7. 2070883Species Streptomyces sp. [TaxId:1931] [63860] (2 PDB entries)
  8. 2070884Domain d1e5sa_: 1e5s A: [59278]
    iron form
    complexed with fe2, so4

Details for d1e5sa_

PDB Entry: 1e5s (more details), 2.4 Å

PDB Description: proline 3-hydroxylase (type ii) - iron form
PDB Compounds: (A:) proline oxidase

SCOPe Domain Sequences for d1e5sa_:

Sequence, based on SEQRES records: (download)

>d1e5sa_ b.82.2.4 (A:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]}
mrshilgkieldqtrlapdlaylaavptveeeydefsngfwkhvplwnasgdsedrlyrd
lkdaaaqptahvehvpylkeivttvfdgthlqmarsrnlknaiviphrdfveldrevdry
frtfmvledsplafhsnedtvihmrpgeiwfldaatvhsavnfseisrqslcvdfafdgp
fdekeifadatlyapgstpdlperrpftaehrrrilslgqvierenfrdilfllskvhyk
ydvhpsetydwlieiskqagdekmvvkaeqirdfavearalserfsltsw

Sequence, based on observed residues (ATOM records): (download)

>d1e5sa_ b.82.2.4 (A:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]}
mrshilgkieldqtrlapdlaylaavptveefsngfwkhvplwnqptahvehvpylkeiv
ttvfdgthlqmarsrnlknaiviphrdfryfrtfmvledsplafhsnedtvihmrpgeiw
fldaatvhsavnfseisrqslcvdfafdgpfdekeifadatlyapgstpdlperrpftae
hrrrilslgqvierenfrdilfllskvhykydvhpsetydwlieiskqagdekmvvkaeq
irdfavearalserfsltsw

SCOPe Domain Coordinates for d1e5sa_:

Click to download the PDB-style file with coordinates for d1e5sa_.
(The format of our PDB-style files is described here.)

Timeline for d1e5sa_: