![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.4: Type II Proline 3-hydroxylase (proline oxidase) [63858] (1 protein) |
![]() | Protein Type II Proline 3-hydroxylase (proline oxidase) [63859] (1 species) |
![]() | Species Streptomyces sp. [TaxId:1931] [63860] (2 PDB entries) |
![]() | Domain d1e5rb_: 1e5r B: [59277] apo form |
PDB Entry: 1e5r (more details), 2.3 Å
SCOPe Domain Sequences for d1e5rb_:
Sequence, based on SEQRES records: (download)
>d1e5rb_ b.82.2.4 (B:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]} mrshilgkieldqtrlapdlaylaavptveeeydefsngfwkhvplwnasgdsedrlyrd lkdaaaqptahvehvpylkeivttvfdgthlqmarsrnlknaiviphrdfveldrevdry frtfmvledsplafhsnedtvihmrpgeiwfldaatvhsavnfseisrqslcvdfafdgp fdekeifadatlyapgstpdlperrpftaehrrrilslgqvierenfrdilfllskvhyk ydvhpsetydwlieiskqagdekmvvkaeqirdfavearalserfsltsw
>d1e5rb_ b.82.2.4 (B:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]} mrshilgkieldqtrlapdlaylaavptveefsngfwkhvplwnaptahvehvpylkeiv ttvfdgthlqmarsrnlknaiviphrdfveryfrtfmvledsplafhsnedtvihmrpge iwfldaatvhsavnfseisrqslcvdfafdgpfdekeifadatlyapgstpdlperrpft aehrrrilslgqvierenfrdilfllskvhykydvhpsetydwlieiskqagdekmvvka eqirdfavearalserfsltsw
Timeline for d1e5rb_: