Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.4: Type II Proline 3-hydroxylase (proline oxidase) [63858] (1 protein) |
Protein Type II Proline 3-hydroxylase (proline oxidase) [63859] (1 species) |
Species Streptomyces sp. [TaxId:1931] [63860] (2 PDB entries) |
Domain d1e5ra_: 1e5r A: [59276] apo form |
PDB Entry: 1e5r (more details), 2.3 Å
SCOPe Domain Sequences for d1e5ra_:
Sequence, based on SEQRES records: (download)
>d1e5ra_ b.82.2.4 (A:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]} mrshilgkieldqtrlapdlaylaavptveeeydefsngfwkhvplwnasgdsedrlyrd lkdaaaqptahvehvpylkeivttvfdgthlqmarsrnlknaiviphrdfveldrevdry frtfmvledsplafhsnedtvihmrpgeiwfldaatvhsavnfseisrqslcvdfafdgp fdekeifadatlyapgstpdlperrpftaehrrrilslgqvierenfrdilfllskvhyk ydvhpsetydwlieiskqagdekmvvkaeqirdfavearalserfsltsw
>d1e5ra_ b.82.2.4 (A:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]} mrshilgkieldqtrlapdlaylaavptveefsngfwkhvplwnqptahvehvpylkeiv ttvfdgthlqmarsrnlknaiviphrdfryfrtfmvledsplafhsnedtvihmrpgeiw fldaatvhsavnfseisrqslcvdfafdgpfdekeifadatlyapgstpdlperrpftae hrrrilslgqvierenfrdilfllskvhykydvhpsetydwlieiskqagdekmvvkaeq irdfavearalserfsltsw
Timeline for d1e5ra_: